| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FGF-4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FGF-4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FGF-4. This antibody reacts with human. The FGF-4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FGF-4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFL |
|---|
| Other Names | fibroblast growth factor 4, HBGF-4Transforming protein KS3, heparin secretory transforming protein 1, Heparin secretory-transforming protein 1, Heparin-binding growth factor 4, HST-1HSTF-1, HSTF1fibroblast growth factor 4 splice isoform, HSTFGF-4, human stomach cancer, transforming factor from FGF-related oncogene, kaposi sarcoma oncogene, KFGF, K-FGF, KS3, oncogene HST |
|---|
| Gene, Accession # | FGF4, Gene ID: 2249 |
|---|
| Catalog # | NBP1-83291 |
|---|
| Price | |
|---|
| Order / More Info | FGF-4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|