| Edit |   |
|---|
| Antigenic Specificity | FGF-3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FGF-3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FGF-3. This antibody reacts with rat. The FGF-3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human Fgf3. Peptide sequence KGRPRRGFKTRRTQKSSLFLPRVLGHKDHEMVRLLQSGQPQAPGEGSQPR. |
|---|
| Other Names | fibroblast growth factor 3, fibroblast growth factor 3 (murine mammary tumor virus integration site (v-int-2) oncogene homolog), HBGF-3, mouse, oncogene INT2 |
|---|
| Gene, Accession # | FGF3, Gene ID: 2248, Accession: NP_570830 |
|---|
| Catalog # | NBP1-80503-20ul |
|---|
| Price | |
|---|
| Order / More Info | FGF-3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|