| Edit |   |
| Antigenic Specificity | PGBD4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PGBD4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PGBD4. This antibody reacts with human. The PGBD4 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PGBD4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PLSHLESDGKSSTSSDSGRSMKWSARAMIPRQRYDFTGTPGRKVDVSDITDPLQYFELFFTEELVSKITRETNAQAALLASKPPGPKGFSRMDKWKD |
| Other Names | FLJ32638, FLJ37497, piggyBac transposable element derived 4, piggyBac transposable element-derived protein 4 |
| Gene, Accession # | PGBD4, Gene ID: 161779 |
| Catalog # | NBP2-56747 |
| Price | |
| Order / More Info | PGBD4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |