| Edit |   |
| Antigenic Specificity | PGBD3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PGBD3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PGBD3. This antibody reacts with human. The PGBD3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to PGBD3(piggyBac transposable element derived 3) The peptide sequence was selected from the N terminal of PGBD3. Peptide sequence AESDSDDPSYAPKDDSPDEVPSTFTVQQPPPSRRRKMTKILCKWKKADLT. |
| Other Names | FLJ90201, piggyBac transposable element derived 3, piggyBac transposable element-derived protein 3 |
| Gene, Accession # | PGBD3, Gene ID: 267004, Accession: Q8N328, SwissProt: Q8N328 |
| Catalog # | NBP1-57117 |
| Price | |
| Order / More Info | PGBD3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |