| Edit |   |
|---|
| Antigenic Specificity | MON1B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MON1B Antibody from Novus Biologicals is a rabbit polyclonal antibody to MON1B. This antibody reacts with human. The MON1B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MON1B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EVGGDTAAPAPGGAEDLEDTQFPSEEAREGGGVHAVPPDPEDEGLEETGSKDKDQPPSPSPPPQSEALSSTSRL |
|---|
| Other Names | HSRG1HSV-I stimulating-related protein, HSV-1 stimulation-related gene 1 protein, KIAA0872vacuolar fusion protein MON1 homolog B, MON1 homolog B (yeast), SAND2SRG1 |
|---|
| Gene, Accession # | MON1B, Gene ID: 22879, Accession: Q7L1V2, SwissProt: Q7L1V2 |
|---|
| Catalog # | NBP1-92131 |
|---|
| Price | |
|---|
| Order / More Info | MON1B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26987402, 30368516 |
|---|