| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SIRT7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SIRT7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SIRT7. This antibody reacts with human. The SIRT7 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SIRT7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TPKDDWAALKLHGKCDDVMRLLMAELGLEIPAYSRWQDPIFSLATPLRAGEEGSHSRKSLCRSREEAPPGDRGAPLSSAPILGGWFGRGCTKRTK |
|---|
| Other Names | EC 3.5.1.-, MGC126840, MGC126842, silent mating type information regulation 2, S.cerevisiae, homolog 7, SIR2L7NAD-dependent deacetylase sirtuin-7, SIR2-like protein 7, sir2-related protein type 7, sirtuin (silent mating type information regulation 2 homolog) 7 (S. cerevisiae), sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 7, sirtuin 7, sirtuin type 7 |
|---|
| Gene, Accession # | SIRT7, Gene ID: 51547 |
|---|
| Catalog # | NBP2-47276 |
|---|
| Price | |
|---|
| Order / More Info | SIRT7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|