| Edit |   |
|---|
| Antigenic Specificity | Tryptophan rich protein |
|---|
| Clone | 4D6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Tryptophan rich protein Antibody (4D6) from Novus Biologicals is a mouse monoclonal antibody to Tryptophan rich protein. This antibody reacts with human. The Tryptophan rich protein Antibody (4D6) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | WRB (NP_004618, 29 a.a. - 101 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSFSSFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIK |
|---|
| Other Names | congenital heart disease 5 protein10tryptophan-rich protein, FLJ51808, tryptophan rich basic protein |
|---|
| Gene, Accession # | WRB, Gene ID: 7485, Accession: NP_004618, SwissProt: NP_004618 |
|---|
| Catalog # | H00007485-M05 |
|---|
| Price | |
|---|
| Order / More Info | Tryptophan rich protein Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|