| Edit |   |
|---|
| Antigenic Specificity | Tryptophan rich protein |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 24993940). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Tryptophan rich protein Antibody from Novus Biologicals is a rabbit polyclonal antibody to Tryptophan rich protein. This antibody reacts with human. The Tryptophan rich protein Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Tryptophan rich protein antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIK |
|---|
| Other Names | congenital heart disease 5 protein10tryptophan-rich protein, FLJ51808, tryptophan rich basic protein |
|---|
| Gene, Accession # | WRB, Gene ID: 7485 |
|---|
| Catalog # | NBP1-84492 |
|---|
| Price | |
|---|
| Order / More Info | Tryptophan rich protein Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24993940 |
|---|