| Edit |   |
|---|
| Antigenic Specificity | SV2A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SV2A Antibody from Novus Biologicals is a rabbit polyclonal antibody to SV2A. This antibody reacts with human. The SV2A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SV2A(synaptic vesicle glycoprotein 2A) The peptide sequence was selected from the middle region of SV2A. Peptide sequence LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT. |
|---|
| Other Names | KIAA0736SV2, synaptic vesicle glycoprotein 2A |
|---|
| Gene, Accession # | SV2A, Gene ID: 9900, Accession: Q7L0J3, SwissProt: Q7L0J3 |
|---|
| Catalog # | NBP1-59666-100ul |
|---|
| Price | |
|---|
| Order / More Info | SV2A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|