| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Sirtuin 5/SIRT5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 26658802). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Sirtuin 5/SIRT5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Sirtuin 5/SIRT5. This antibody reacts with human. The Sirtuin 5/SIRT5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Sirtuin 5/SIRT5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEAL |
|---|
| Other Names | EC 3.5.1, EC 3.5.1.-, FLJ36950, NAD-dependent deacetylase sirtuin-5, silent mating type information regulation 2, S.cerevisiae, homolog 5, SIR2L5, sir2-like 5, SIR2-like protein 5, sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae), sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 5, sirtuin 5, sirtuin type 5 |
|---|
| Gene, Accession # | SIRT5, Gene ID: 23408 |
|---|
| Catalog # | NBP1-86013 |
|---|
| Price | |
|---|
| Order / More Info | Sirtuin 5/SIRT5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26658802 |
|---|
| 产品资料 |
|
|