| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PACE4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PACE4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PACE4. This antibody reacts with human. The PACE4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PACE4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RPVYTNHWAVQVLGGPAEADRVAAAHGYLNLGQIGNLEDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKRRVKR |
|---|
| Other Names | EC 3.4.21, EC 3.4.21.61, EC 3.4.21.75, PACE4EC 3.4.21.-, Paired basic amino acid cleaving enzyme 4, paired basic amino acid cleaving system 4, proprotein convertase subtilisin/kexin type 6, SPC4subtilisin-like protease, Subtilisin/kexin-like protease PACE4, Subtilisin-like proprotein convertase 4 |
|---|
| Gene, Accession # | PCSK6, Gene ID: 5046 |
|---|
| Catalog # | NBP1-87354 |
|---|
| Price | |
|---|
| Order / More Info | PACE4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23908247 |
|---|
| 产品资料 |
|
|