| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PABPC1L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PABPC1L Antibody from Novus Biologicals is a rabbit polyclonal antibody to PABPC1L. This antibody reacts with human. The PABPC1L Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PABPC1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ILTNQYMQRLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAYYGCGPVTPTQP |
|---|
| Other Names | C20orf119, Chromosome 20 Open Reading Frame 119, DJ1069P2.3, Embryonic Poly(A) Binding Protein, EPAB, PABPC1L1, Poly(A) Binding Protein Cytoplasmic 1 Like, Poly(A) Binding Protein, Cytoplasmic 1-Like, Polyadenylate-Binding Protein 1-Like |
|---|
| Gene, Accession # | PABPC1L, Gene ID: 80336 |
|---|
| Catalog # | NBP2-55978 |
|---|
| Price | |
|---|
| Order / More Info | PABPC1L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|