| Edit |   |
| Antigenic Specificity | FAM173B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FAM173B Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM173B. This antibody reacts with human. The FAM173B Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LOC134145 The peptide sequence was selected from the N terminal of LOC134145. Peptide sequence EGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAV. |
| Other Names | family with sequence similarity 173, member B, FLJ20667, hypothetical protein LOC134145 |
| Gene, Accession # | FAM173B, Gene ID: 134145, Accession: Q6P4H8, SwissProt: Q6P4H8 |
| Catalog # | NBP1-60086 |
| Price | |
| Order / More Info | FAM173B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |