| Edit |   |
|---|
| Antigenic Specificity | FAM170b |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM170b Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM170b. This antibody reacts with mouse. The FAM170b Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is Fam170b - middle region. Peptide sequence QQPVEEEQSLSDSSECTRLLTKVLPWQQQPQQQPQEQQKQQQQQQQKQRQ. |
|---|
| Other Names | putative protein FAM170B, C10orf73, family with sequence similarity 170, member B |
|---|
| Gene, Accession # | FAM170B, Gene ID: 170370, Accession: NP_001157957 |
|---|
| Catalog # | NBP1-98265 |
|---|
| Price | |
|---|
| Order / More Info | FAM170b Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|