| Edit |   |
|---|
| Antigenic Specificity | LRRC49 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LRRC49 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRC49. This antibody reacts with human. The LRRC49 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LRRC49(leucine rich repeat containing 49) The peptide sequence was selected from the N terminal of LRRC49. Peptide sequence KVEFKLNKDTSSFPGRLLQHDLERNYSSRQGDHINLVSSSLSSFPILQRS. |
|---|
| Other Names | FLJ20156, leucine rich repeat containing 49, leucine-rich repeat-containing protein 49, PGs4, Tubulin polyglutamylase complex subunit 4 |
|---|
| Gene, Accession # | LRRC49, Gene ID: 54839, Accession: Q8IUZ0, SwissProt: Q8IUZ0 |
|---|
| Catalog # | NBP1-56473-20ul |
|---|
| Price | |
|---|
| Order / More Info | LRRC49 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|