| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LRRC44 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LRRC44 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRC44. This antibody reacts with human, rat. The LRRC44 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, rat LRRC44 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MFHGTVTEELTSHEEWSHYNENIREGQKDFVFVKFNGLHLKSMENLQSCISLRVCIFSNNFITDIHPLQSCIKLIKLDLHGN |
|---|
| Other Names | leucine rich repeat containing 44, leucine-rich repeat and IQ domain-containing protein 3, Leucine-rich repeat-containing protein 44, leucine-rich repeats and IQ motif containing 3, LRRC44, MGC22773 |
|---|
| Gene, Accession # | LRRIQ3, Gene ID: 127255 |
|---|
| Catalog # | NBP1-92078 |
|---|
| Price | |
|---|
| Order / More Info | LRRC44 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|