| Edit |   |
|---|
| Antigenic Specificity | LRRC42 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LRRC42 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRC42. This antibody reacts with human. The LRRC42 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LRRC42(leucine rich repeat containing 42) The peptide sequence was selected from the N terminal of LRRC42. Peptide sequence LIGFPEQIAEKLFSAAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLR. |
|---|
| Other Names | dJ167A19.4, leucine rich repeat containing 42, leucine-rich repeat-containing protein 42, MGC8974 |
|---|
| Gene, Accession # | LRRC42, Gene ID: 115353, Accession: Q9Y546, SwissProt: Q9Y546 |
|---|
| Catalog # | NBP1-56701-20ul |
|---|
| Price | |
|---|
| Order / More Info | LRRC42 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|