| Edit |   |
| Antigenic Specificity | LRRC42 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LRRC42 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRC42. This antibody reacts with human. The LRRC42 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human LRRC42 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YGSLVLCSLCLRNRYLVISEKLEEIKSFRELTCLDLSCCKLGDEHELLEHLTNEALSSVTQLHLKDNCLSDAGVRKMTAPVRVMKR |
| Other Names | dJ167A19.4, leucine rich repeat containing 42, leucine-rich repeat-containing protein 42, MGC8974 |
| Gene, Accession # | LRRC42, Gene ID: 115353, Accession: Q9Y546, SwissProt: Q9Y546 |
| Catalog # | NBP2-30483 |
| Price | |
| Order / More Info | LRRC42 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |