| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LRRC41 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LRRC41 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRC41. This antibody reacts with human. The LRRC41 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human LRRC41 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KPLKRFKRAAGKKGARTRQGPGAESEDLYDFVFIVAGEKEDGEEMEIGEV ACGALDGSDPSCLGLPALEASQRF |
|---|
| Other Names | leucine rich repeat containing 41, leucine-rich repeat-containing protein 41, MGC126571, MGC126573, MUF1 protein (MUF1), MUF1elongin BC-interacting leucine-rich repeat protein, Protein Muf1, RP4-636H5.2 |
|---|
| Gene, Accession # | LRRC41, Gene ID: 10489 |
|---|
| Catalog # | NBP2-14200 |
|---|
| Price | |
|---|
| Order / More Info | LRRC41 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|