| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CCT3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for T-complex protein 1 subunit gamma(CCT3) detection. Tested with WB, IHC-P, IHC-F, ICC/IF, FCM in Human;Rat. No cross reactivity with other proteins. T-complex protein 1 subunit gamma is a protein that in humans is encoded by the CCT3 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ), different from the related mouse and rat sequences by one amino acid. |
|---|
| Other Names | T-complex protein 1 subunit gamma;TCP-1-gamma;CCT-gamma;hTRiC5;CCT3;CCTG, TRIC5; |
|---|
| Gene, Accession # | CCT3, UniProt: P49368 |
|---|
| Catalog # | PB9926 |
|---|
| Price | |
|---|
| Order / More Info | CCT3 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|