| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Kir2.2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Kir2.2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Kir2.2. This antibody reacts with human. The Kir2.2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Kir2 |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI |
|---|
| Other Names | ATP-sensitive inward rectifier potassium channel 12, hIRK, hIRK1, hkir2.2x, Inward rectifier K(+) channel Kir2.2, Inward rectifier K(+) channel Kir2.2v, inward rectifier K(+) channel Kir2.6, IRK2IRK-2, kcnj12x, KCNJN1FLJ14167, Kir2.2, Kir2.2v, Potassium channel, inwardly rectifying subfamily J member 12, potassium inwardly-rectifying channel, subfamily J, inhibitor 1, potassium inwardly-rectifying channel, subfamily J, member 12 |
|---|
| Gene, Accession # | KCNJ12, Gene ID: 3768 |
|---|
| Catalog # | NBP1-89696 |
|---|
| Price | |
|---|
| Order / More Info | Kir2.2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|