| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Kir2.1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Kir2.1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Kir2.1. This antibody reacts with human. The Kir2.1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Kir2 |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEDDSENGVPES |
|---|
| Other Names | Cardiac inward rectifier potassium channel, HHBIRK1, HHIRK1, hIRK1, Inward rectifier K(+) channel Kir2.1, inward rectifier K+ channel KIR2.1, inward rectifier potassium channel 2, IRK-1, IRK1LQT7, Kir2.1, Potassium channel, inwardly rectifying subfamily J member 2, potassium inwardly-rectifying channel, subfamily J, member 2, SQT3 |
|---|
| Gene, Accession # | KCNJ2, Gene ID: 3759 |
|---|
| Catalog # | NBP1-87709 |
|---|
| Price | |
|---|
| Order / More Info | Kir2.1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|