| Edit |   |
|---|
| Antigenic Specificity | Kinesin C2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Kinesin C2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Kinesin C2. This antibody reacts with human. The Kinesin C2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to KIFC2 (kinesin family member C2) The peptide sequence was selected from the N terminal of KIFC2. Peptide sequence VRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLE. |
|---|
| Other Names | kinesin family member C2, kinesin-like protein KIFC2 |
|---|
| Gene, Accession # | KIFC2, Gene ID: 90990, Accession: Q96AC6, SwissProt: Q96AC6 |
|---|
| Catalog # | NBP1-58247 |
|---|
| Price | |
|---|
| Order / More Info | Kinesin C2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|