| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BACE-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BACE-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BACE-1. This antibody reacts with human, mouse, rat. The BACE-1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to BACE1/beta-secretase 1 (beta-site APP-cleaving enzyme 1) The peptide sequence was selected from the N terminal of BACE1/beta-secretase 1 (NP_036236). Peptide sequence GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY. |
|---|
| Other Names | APP beta-secretase, ASP2, Aspartyl protease 2, BACEAsp 2, beta-secretase 1, beta-secretase 1 precursor variant 1, beta-site amyloid beta A4 precursor protein-cleaving enzyme, Beta-site amyloid precursor protein cleaving enzyme 1, Beta-site APP cleaving enzyme 1, beta-site APP-cleaving enzyme, beta-site APP-cleaving enzyme 1, EC 3.4.23, EC 3.4.23.46, FLJ90568, HSPC104, KIAA1149, Memapsin-2, Membrane-associated aspartic protease 2, transmembrane aspartic proteinase Asp2 |
|---|
| Gene, Accession # | BACE1, Gene ID: 23621, Accession: P56817, SwissProt: P56817 |
|---|
| Catalog # | NBP1-62416 |
|---|
| Price | |
|---|
| Order / More Info | BACE-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|