| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BAAT |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BAAT Antibody from Novus Biologicals is a rabbit polyclonal antibody to BAAT. This antibody reacts with human. The BAAT Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human BAAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MIQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHY RANEFGEVDLNHASSLGGDYMGVH |
|---|
| Other Names | BACAT, BATbile acid-CoA:amino acid N-acyltransferase, bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase), bile acid Coenzyme A: amino acid N-acyltransferase (glycineN-choloyltransferase), EC 2.3.1.65, EC 3.1.2.2, FLJ20300, Glycine N-choloyltransferase, Long-chain fatty-acyl-CoA hydrolase, MGC104432 |
|---|
| Gene, Accession # | BAAT, Gene ID: 570 |
|---|
| Catalog # | NBP2-14344 |
|---|
| Price | |
|---|
| Order / More Info | BAAT Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|