| Edit |   |
| Antigenic Specificity | DGCR6L |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DGCR6L Antibody from Novus Biologicals is a rabbit polyclonal antibody to DGCR6L. This antibody reacts with human. The DGCR6L Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human DGCR6LThe immunogen for this antibody is DGCR6L. Peptide sequence QQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTT. |
| Other Names | DiGeorge syndrome critical region 6-like protein, DiGeorge syndrome critical region gene 6 like, DiGeorge syndrome critical region gene 6-like, FLJ10666, protein DGCR6L |
| Gene, Accession # | DGCR6L, Gene ID: 85359, Accession: NP_150282, SwissProt: NP_150282 |
| Catalog # | NBP1-79875 |
| Price | |
| Order / More Info | DGCR6L Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |