| 产品详情 |
| Edit |   |
| Antigenic Specificity | LRPAP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LRPAP Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRPAP. This antibody reacts with human. The LRPAP Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to LRPAP1(low density lipoprotein receptor-related protein associated protein 1) The peptide sequence was selected from the C terminal of LRPAP1. Peptide sequence IDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEI |
| Other Names | A2MRAPMRAP, A2RAP, alpha-2-macroglobulin receptor-associated protein, alpha-2-macroglobulin receptor-associated protein 1, Alpha-2-MRAP, HBP44, lipoprotein receptor associated protein, low density lipoprotein receptor-related protein associated protein 1, Low density lipoprotein receptor-related protein-associated protein 1, low density lipoprotein-related protein-associated protein 1(alpha-2-macroglobulin receptor-associated protein 1), MGC138272, RAP |
| Gene, Accession # | LRPAP1, Gene ID: 4043, Accession: P30533, SwissProt: P30533 |
| Catalog # | NBP1-69362 |
| Price | |
| Order / More Info | LRPAP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|