| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD161 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD161 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD161. This antibody reacts with human. The CD161 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CD161 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIH |
|---|
| Other Names | CD161, CD161 antigen, CLEC5BC-type lectin domain family 5 member B, HNKR-P1a, killer cell lectin-like receptor subfamily B member 1, killer cell lectin-like receptor subfamily B, member 1, Natural killer cell surface protein P1A, NKR-P1, NKR-P1AMGC138614, NKRP1ANKR |
|---|
| Gene, Accession # | KLRB1, Gene ID: 3820, Accession: Q12918, SwissProt: Q12918 |
|---|
| Catalog # | NBP1-88130 |
|---|
| Price | |
|---|
| Order / More Info | CD161 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|