| Edit |   |
|---|
| Antigenic Specificity | CD160 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 50ul |
|---|
| Concentration | lyophilized |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD160 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD160. This antibody reacts with human. The CD160 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CD160(CD160 molecule) The peptide sequence was selected from the middle region of CD160. Peptide sequence SGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEG. |
|---|
| Other Names | BY55FLJ46513, CD160 antigenimmunoglobulin superfamily member, CD160 molecule, Natural killer cell receptor BY55 |
|---|
| Gene, Accession # | CD160, Gene ID: 11126, Accession: O95971, SwissProt: O95971 |
|---|
| Catalog # | NBP1-58868 |
|---|
| Price | |
|---|
| Order / More Info | CD160 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|