| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | S100A8 |
|---|
| Clone | 1B3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The S100A8 Antibody (1B3) from Novus Biologicals is a mouse monoclonal antibody to S100A8. This antibody reacts with human. The S100A8 Antibody (1B3) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | S100A8 (AAH05928.1, 1 a.a. - 93 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE |
|---|
| Other Names | 60B8AG, CAGACP-10, calgranulin A, calgranulin-A, Calprotectin L1L subunit, CFAGL1Ag, CGLA, Cystic fibrosis antigen, Leukocyte L1 complex light chain, MA387, MIF, Migration inhibitory factor-related protein 8, MRP-8, MRP8S100 calcium binding protein A8 (calgranulin A), NIF, P8, protein S100-A8, S100 calcium binding protein A8, S100 calcium-binding protein A8, S100 calcium-binding protein A8 (calgranulin A), Urinary stone protein band A |
|---|
| Gene, Accession # | S100A8, Gene ID: 6279, Accession: AAH05928, SwissProt: AAH05928 |
|---|
| Catalog # | H00006279-M02 |
|---|
| Price | |
|---|
| Order / More Info | S100A8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|