| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PCBP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PCBP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PCBP2. This antibody reacts with human. The PCBP2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PCBP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEG |
|---|
| Other Names | alpha-CP2, Heterogeneous nuclear ribonucleoprotein E2, heterogenous nuclear ribonucleoprotein E2, hnRNP E2, hnRNP-E2, HNRPE2, MGC110998, poly(rC) binding protein 2, poly(rC)-binding protein 2 |
|---|
| Gene, Accession # | PCBP2, Gene ID: 5094 |
|---|
| Catalog # | NBP1-83241 |
|---|
| Price | |
|---|
| Order / More Info | PCBP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25411354 |
|---|
| 产品资料 |
|
|