| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GNG2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GNG2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GNG2. This antibody reacts with human. The GNG2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GNG2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREK |
|---|
| Other Names | G gamma-I, guanine nucleotide binding protein (G protein), gamma 2, guanine nucleotide binding protein gamma 2, guanine nucleotide-binding protein G(I)/G(O) gamma-2 subunit, guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 |
|---|
| Gene, Accession # | GNG2, Gene ID: 54331 |
|---|
| Catalog # | NBP1-86156 |
|---|
| Price | |
|---|
| Order / More Info | GNG2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22957104, 24734007 |
|---|
| 产品资料 |
|
|