| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GNG13 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GNG13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GNG13. This antibody reacts with human. The GNG13 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GNG13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL |
|---|
| Other Names | G gamma subunit, clone:h2-35, G(gamma)13, guanine nucleotide binding protein (G protein), gamma 13, guanine nucleotide binding protein 13, gamma, guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13, h2-35 |
|---|
| Gene, Accession # | GNG13, Gene ID: 51764 |
|---|
| Catalog # | NBP1-91950 |
|---|
| Price | |
|---|
| Order / More Info | GNG13 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|