| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GNG11 |
|---|
| Clone | 2H5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Proximity Ligation Assay. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GNG11 Antibody (2H5) from Novus Biologicals is a mouse monoclonal antibody to GNG11. This antibody reacts with human. The GNG11 Antibody (2H5) has been validated for the following applications: Western Blot, ELISA, Proximity Ligation Assay. |
|---|
| Immunogen | GNG11 (NP_004117.1, 1 a.a. - 69 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGS |
|---|
| Other Names | GNGT11G protein gamma-11 subunit, guanine nucleotide binding protein (G protein), gamma 11, guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-11 subunit, guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11 |
|---|
| Gene, Accession # | GNG11, Gene ID: 2791, Accession: NP_004117, SwissProt: NP_004117 |
|---|
| Catalog # | H00002791-M01 |
|---|
| Price | |
|---|
| Order / More Info | GNG11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|