| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GNB1L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GNB1L Antibody from Novus Biologicals is a rabbit polyclonal antibody to GNB1L. This antibody reacts with human. The GNB1L Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to GNB1L (guanine nucleotide binding protein (G protein), beta polypeptide 1-like) The peptide sequence was selected from the C terminal of GNB1L. Peptide sequence RVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRI |
|---|
| Other Names | DGCRK3, G-protein beta subunit-like protein, guanine nucleotide binding protein (G protein), beta polypeptide 1-like, guanine nucleotide binding protein beta-subunit-like polypeptide, guanine nucleotide-binding protein subunit beta-like protein 1, GY2WD40 repeat-containing protein deleted in VCFS, KIAA1645, WD repeat-containing protein 14, WDR14G protein subunit beta-like protein 1, WDVCF |
|---|
| Gene, Accession # | GNB1L, Gene ID: 54584, Accession: Q9BYB4, SwissProt: Q9BYB4 |
|---|
| Catalog # | NBP1-58342-20ul |
|---|
| Price | |
|---|
| Order / More Info | GNB1L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|