| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GNB5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GNB5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GNB5. This antibody reacts with human. The GNB5 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human GNB5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGT |
|---|
| Other Names | FLJ37457, FLJ43714, G protein, beta subunit 5L, G protein, beta-5 subunit, GB5, gbeta5, guanine nucleotide binding protein (G protein), beta 5, guanine nucleotide-binding protein subunit beta-5, guanine nucleotide-binding protein, beta subunit 5L, Transducin beta chain 5 |
|---|
| Gene, Accession # | GNB5, Gene ID: 10681 |
|---|
| Catalog # | NBP2-58164 |
|---|
| Price | |
|---|
| Order / More Info | GNB5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|