| Edit |   |
|---|
| Antigenic Specificity | GNB2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GNB2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GNB2. This antibody reacts with human. The GNB2 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: beta-2 |
|---|
| Immunogen | Synthetic peptides corresponding to GNB2(guanine nucleotide binding protein (G protein), beta polypeptide 2) The peptide sequence was selected from the middle region of GNB2. Peptide sequence CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAP |
|---|
| Other Names | beta-2 subunit, guanine nucleotide binding protein (G protein), beta polypeptide 2, guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2, guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2, signal-transducing guanine nucleotide-binding regulatory protein beta subunit |
|---|
| Gene, Accession # | GNB2, Gene ID: 2783, Accession: P62879, SwissProt: P62879 |
|---|
| Catalog # | NBP1-55323 |
|---|
| Price | |
|---|
| Order / More Info | GNB2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|