| Edit |   |
|---|
| Antigenic Specificity | GNAQ |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GNAQ Antibody from Novus Biologicals is a rabbit polyclonal antibody to GNAQ. This antibody reacts with human. The GNAQ Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: alpha |
|---|
| Immunogen | Synthetic peptides corresponding to GNAQ(guanine nucleotide binding protein (G protein), q polypeptide) The peptide sequence was selected from the N terminal of GNAQ. Peptide sequence DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK. |
|---|
| Other Names | GAQG-ALPHA-q, guanine nucleotide binding protein (G protein), q polypeptide, Guanine nucleotide-binding protein alpha-q, guanine nucleotide-binding protein G(q) subunit alpha |
|---|
| Gene, Accession # | GNAQ, Gene ID: 2776, Accession: P50148, SwissProt: P50148 |
|---|
| Catalog # | NBP1-58311 |
|---|
| Price | |
|---|
| Order / More Info | GNAQ Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|