| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MAN2C1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MAN2C1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAN2C1. This antibody reacts with human. The MAN2C1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MAN2C1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LGKDNQRSFQALYTANQMVNVCDPAQPETFPVAQALASRFFGQHGGESQHTIHATGHCHIDTAWLWPFKETVRKCARSWVTALQLMERNP |
|---|
| Other Names | Alpha mannosidase 6A8B, Alpha-D-mannoside mannohydrolase, alpha-mannosidase 2C1, DKFZp686E23167, EC 3.2.1.24, MAN6A8, MANA1, MANAMGC87979, Mannosidase alpha class 2C member 1, mannosidase, alpha 6A8, mannosidase, alpha A, cytoplasmic, mannosidase, alpha, class 2C, member 1 |
|---|
| Gene, Accession # | MAN2C1, Gene ID: 4123 |
|---|
| Catalog # | NBP2-57246 |
|---|
| Price | |
|---|
| Order / More Info | MAN2C1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|