| 产品详情 |
| Edit |   |
| Antigenic Specificity | MAN1A2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 24591635). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MAN1A2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAN1A2. This antibody reacts with human. The MAN1A2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MAN1A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KLRKSREEIRAEIQTEKNKVVQEMKIKENKPLPPVPIPNLVGIRGGDPEDNDIREK |
| Other Names | Alpha-1,2-mannosidase IB, EC 3.2.1.113, MAN1Balpha1,2-mannosidase, Mannosidase alpha class 1A member 2, mannosidase, alpha, class 1A, member 2, mannosyl-oligosaccharide 1,2-alpha-mannosidase IB, Processing alpha-1,2-mannosidase IB |
| Gene, Accession # | MAN1A2, Gene ID: 10905, Accession: O60476, SwissProt: O60476 |
| Catalog # | NBP1-82802 |
| Price | |
| Order / More Info | MAN1A2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 24591635 |
| 产品资料 |
|
|