| Edit |   |
|---|
| Antigenic Specificity | KDELR3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KDELR3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KDELR3. This antibody reacts with human. The KDELR3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to KDELR3(KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 3) The peptide sequence was selected form the middle region of KDELR3. Peptide sequence AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILW. |
|---|
| Other Names | ER lumen protein retaining receptor 3, ERD2L3, KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 3, KDEL endoplasmic reticulum protein retention receptor 3, KDEL receptor 3 |
|---|
| Gene, Accession # | KDELR3, Gene ID: 11015, Accession: O43731, SwissProt: O43731 |
|---|
| Catalog # | NBP1-62653-20ul |
|---|
| Price | |
|---|
| Order / More Info | KDELR3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|