| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KDELR2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KDELR2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KDELR2. This antibody reacts with human. The KDELR2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human KDELR2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YSRERSSVCQHKCQRPSPASVLQGARTEFLPQQRHKMLDTENQKLNSFVADSHQWLCK |
|---|
| Other Names | ELP-1(Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2, ER lumen protein retaining receptor 2, ERD2.2FLJ45532, ERD-2-like protein, ERD2-like protein 1, KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2, KDEL endoplasmic reticulum protein retention receptor 2, KDEL receptor 2 |
|---|
| Gene, Accession # | KDELR2, Gene ID: 11014 |
|---|
| Catalog # | NBP1-83982 |
|---|
| Price | |
|---|
| Order / More Info | KDELR2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|