| 产品详情 |
| Edit |   |
| Antigenic Specificity | SUGT1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SUGT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SUGT1. This antibody reacts with human. The SUGT1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SUGT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWK |
| Other Names | Protein 40-6-3, putative 40-6-3 protein, Sgt1, SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae), SGT1B protein, suppressor of G2 allele of SKP1 homolog, suppressor of G2 allele of SKP1, S. cerevisiae, homolog of |
| Gene, Accession # | SUGT1, Gene ID: 10910, Accession: Q9Y2Z0, SwissProt: Q9Y2Z0 |
| Catalog # | NBP2-38518 |
| Price | |
| Order / More Info | SUGT1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|