| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SUG1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SUG1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SUG1. This antibody reacts with human. The SUG1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SUG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLD |
|---|
| Other Names | MSUG1 protein, p45, p45/SUG26S protease regulatory subunit 8, proteasome (prosome, macropain) 26S subunit, ATPase, 5, proteasome 26S ATPase subunit 5, Proteasome 26S subunit ATPase 5, Proteasome subunit p45, S8, SUG-1, SUG126S proteasome AAA-ATPase subunit RPT6, Tat-binding protein homolog 10, TBP10, thyroid receptor interactor 1, TRIP1Thyroid hormone receptor-interacting protein 1 |
|---|
| Gene, Accession # | PSMC5, Gene ID: 5705 |
|---|
| Catalog # | NBP2-57621 |
|---|
| Price | |
|---|
| Order / More Info | SUG1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|