| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SUMO2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SUMO2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SUMO2. This antibody reacts with human. The SUMO2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SUMO2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYC |
|---|
| Other Names | HSMT3, MGC117191, sentrin 2, Sentrin-2, small ubiquitin-like modifier 2, small ubiquitin-related modifier 2, SMT3 (suppressor of mif two 3, yeast) homolog 2, SMT3 homolog 2, SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae), SMT3 suppressor of mif two 3 homolog 2 (yeast), SMT3A, SMT3B, SMT3H2, SUMO-2, SUMO3, SUMO-3, Ubiquitin-like protein SMT3A, ubiquitin-like protein SMT3B |
|---|
| Gene, Accession # | SUMO2, Gene ID: 6613, Accession: A8MU27 |
|---|
| Catalog # | NBP2-46758 |
|---|
| Price | |
|---|
| Order / More Info | SUMO2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|