| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SUMO1 |
|---|
| Clone | 3D7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. It has been used for ELISA and WB. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SUMO1 Antibody (3D7) from Novus Biologicals is a mouse monoclonal antibody to SUMO1. This antibody reacts with human. The SUMO1 Antibody (3D7) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | SUMO1 (NP_001005781.1, 1 a.a. - 101 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV |
|---|
| Other Names | DAP1, GAP modifying protein 1, GAP-modifying protein 1, GMP1SMT3CSMT3H3OFC10UBL1PIC1, SENP2, sentrin, small ubiquitin-related modifier 1, SMT3, SMT3 homolog 3, SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae), SMT3 suppressor of mif two 3 homolog 1 (yeast), Smt3C, SUMO-1, Ubiquitin-homology domain protein PIC1, ubiquitin-like 1 (sentrin), Ubiquitin-like protein SMT3C, Ubiquitin-like protein UBL1 |
|---|
| Gene, Accession # | SUMO1, Gene ID: 7341, Accession: NP_001005781, SwissProt: NP_001005781 |
|---|
| Catalog # | H00007341-M03 |
|---|
| Price | |
|---|
| Order / More Info | SUMO1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|