| 产品详情 |
| Edit |   |
| Antigenic Specificity | S100A1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 26259611). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The S100A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to S100A1. This antibody reacts with human, mouse. The S100A1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse S100A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS |
| Other Names | protein S100-A1, S100 alpha, S100 calcium binding protein A1, S100 calcium-binding protein A1S100, S-100 protein alpha chain, S-100 protein subunit alpha, S100 protein, alpha polypeptide, S100A, S100-alpha |
| Gene, Accession # | S100A1, Gene ID: 6271 |
| Catalog # | NBP1-87103 |
| Price | |
| Order / More Info | S100A1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 26259611 |
| 产品资料 |
|
|