| Edit |   |
|---|
| Antigenic Specificity | MVP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MVP Antibody from Novus Biologicals is a rabbit polyclonal antibody to MVP. This antibody reacts with human. The MVP Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MVP(major vault protein) The peptide sequence was selected from the N terminal of MVP. Peptide sequence MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM. |
|---|
| Other Names | LRPVAULT1, Lung resistance-related protein, major vault protein |
|---|
| Gene, Accession # | MVP, Gene ID: 9961, Accession: Q14764, SwissProt: Q14764 |
|---|
| Catalog # | NBP1-52931 |
|---|
| Price | |
|---|
| Order / More Info | MVP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|