| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Nicotinic Acetylcholine R alpha 1/CHRNA1 |
|---|
| Clone | 2G5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (2G5) from Novus Biologicals is a mouse monoclonal antibody to Nicotinic Acetylcholine R alpha 1/CHRNA1. This antibody reacts with human. The Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (2G5) has been validated for the following applications: ELISA. |
|---|
| Immunogen | CHRNA1 (NP_000070.1 146 a.a. - 231 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLP |
|---|
| Other Names | acetylcholine receptor subunit alpha, ACHRA, ACHRD, CHNRA, cholinergic receptor, nicotinic, alpha 1 (muscle), CHRNA, CMS2A, FCCMS, nicotinic acetylcholine receptor alpha subunit, nicotinic cholinergic receptor alpha 1, nicotinic, alpha polypeptide 1 (muscle), SCCMS |
|---|
| Gene, Accession # | CHRNA1, Gene ID: 1134, Accession: NP_000070, SwissProt: NP_000070 |
|---|
| Catalog # | H00001134-M04 |
|---|
| Price | |
|---|
| Order / More Info | Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|