| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Nicotinic Acetylcholine R alpha 1/CHRNA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P: Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nicotinic Acetylcholine R alpha 1/CHRNA1. This antibody reacts with human. The Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Nicotinic Acetylcholine R alpha 1/CHRNA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHF |
|---|
| Other Names | acetylcholine receptor subunit alpha, ACHRA, ACHRD, CHNRA, cholinergic receptor, nicotinic, alpha 1 (muscle), CHRNA, CMS2A, FCCMS, nicotinic acetylcholine receptor alpha subunit, nicotinic cholinergic receptor alpha 1, nicotinic, alpha polypeptide 1 (muscle), SCCMS |
|---|
| Gene, Accession # | CHRNA1, Gene ID: 1134 |
|---|
| Catalog # | NBP2-57262 |
|---|
| Price | |
|---|
| Order / More Info | Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|